PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G16670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 237aa    MW: 25220.1 Da    PI: 7.0554
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G16670.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.2e-12129189363
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      e +r rr+ +NRe+ArrsR RK+ ++ eL + v+ L + N++L +el++    +a ++ e+
  OPUNC08G16670.1 129 EEERRRRMVSNRESARRSRMRKQRQLSELWTQVEHLRGANRRLLDELNRALRGCADVRREN 189
                      66899*******************************************9888887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-9126180No hitNo description
SMARTSM003383.6E-12127191IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611129192IPR004827Basic-leucine zipper domain
PfamPF001701.2E-9131187IPR004827Basic-leucine zipper domain
CDDcd147029.19E-17132180No hitNo description
SuperFamilySSF579591.88E-10132179No hitNo description
PROSITE patternPS000360134149IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MYHHHGGHGE VASLHFLSPP NPPFFGAAAR HHHHGLINMA LPPQAYLVPA GPPPPPPLFQ  60
EATAALAAGD DDDAMAVFEL ERILGEAAAG RLGSGGGGGG GGSNGSPSSG SDGGGVCCYG  120
LQDVAPAAEE ERRRRMVSNR ESARRSRMRK QRQLSELWTQ VEHLRGANRR LLDELNRALR  180
GCADVRRENS RLRDEKAELV EKLQLLLPQP PAAASSNDQS SCSSEPCKNS TTTTAAE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143150RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043761e-152AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
GenBankAP0045571e-152AP004557.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0028A08.
GenBankAP0149641e-152AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649077.13e-89PREDICTED: transcription factor Maf
TrEMBLA0A0E0LW701e-172A0A0E0LW70_ORYPU; Uncharacterized protein
STRINGORGLA08G0162900.12e-89(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-16basic leucine-zipper 42